PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00120571001
Common NameGSBRNA2T00120571001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 315aa    MW: 35590.6 Da    PI: 4.8169
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00120571001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32131185155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+l++ + Lt++hvkSHLQkYR+
  GSBRNA2T00120571001 131 KQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPILTIYHVKSHLQKYRT 185
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-16129185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-29129187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-22131185IPR006447Myb domain, plants
PfamPF002492.4E-9133184IPR001005SANT/Myb domain
PfamPF143794.0E-21219265IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQDCFLEAQS MNHPLPEFSD PLDEFFDFSD HVPALNPQAE SSDLRVGSTV EVHEKSEWQS  60
WADQLMSVDN GSEPNWSELL GDPSPHNPTP TPTPSLDVPR QEMVANHQQQ HQVVSLEEQM  120
NSSASGAATT KQRMRWTPEL HEAFVEAVNQ LGGSERATPK AVLKLLNNPI LTIYHVKSHL  180
QKYRTARYKP ETSEATGEPQ EKKMTSIEDI KSLDMKTSVE ITQALRLQME VQKRLHEQLE  240
TQRALQLQIE KQGRYLQMMF EKQQKLEENK SSSSSKQCNG TSTEVEFESG VVTQIADQSE  300
SAVSVSRKRA REDE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.61141e-169seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00120571001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013677980.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_013677983.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X4
SwissprotQ8GUN51e-166PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078F1B30.0A0A078F1B3_BRANA; BnaC02g39290D protein
STRINGBra020622.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.31e-150G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]